PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v2006250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 342aa    MW: 37749 Da    PI: 9.2589
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v2006250.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.4e-1855115257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Lj6g3v2006250.1  55 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 115
                      89*****************99*************************************995 PP

2Wus_type_Homeobox112.42.3e-3654116264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
    Lj6g3v2006250.1  54 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 116
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-741114IPR009057Homeodomain-like
SuperFamilySSF466892.87E-1250120IPR009057Homeodomain-like
PROSITE profilePS5007110.51151116IPR001356Homeobox domain
SMARTSM003896.8E-953120IPR001356Homeobox domain
CDDcd000866.24E-854116No hitNo description
PfamPF000461.7E-1555115IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNPH HQWQHHDINS SLISTGCHRS TPYTSGCEER SPEPKPRWNP  60
KPEQIRILEA IFNSGMVNPP RDEIRKIRAQ LQEYGQVGDA NVFYWFQNRK SRSKHKLRHL  120
QNAKNHNLNP NNEQPPQNPP SQHPQITAPS SSSSSSSEKS SPKELLPPPP KFSIGFSNVT  180
DVVPNSPTAS VNQTYFHSHN DTTTLLPPPP PPSPTPAESF FFPVQHHATN TLTSQGFCFS  240
ELSNVVQTQP HSSQHNVGPR ASLLFGEFMS HSGGAAASKK DHQDHDKSLK IMHQSPQLNF  300
CFPPTTAPPT TTVVTPTTTT AVPVSSLMTS HVQGTADPGV TA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0105450.0AP010545.1 Lotus japonicus genomic DNA, clone: LjT14H03, TM1489, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517469.11e-142PREDICTED: WUSCHEL-related homeobox 9
TrEMBLA0A0L9VFE31e-140A0A0L9VFE3_PHAAN; Uncharacterized protein
STRINGGLYMA13G21860.21e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-68homeobox-3